Example program for extracting the peptide or protein summary.
/* ############################################################################## # file: resfile_summary.cs # # 'msparser' toolkit example code # ############################################################################## # COPYRIGHT NOTICE # # Copyright 1998-2016 Matrix Science Limited All Rights Reserved. # # # ############################################################################## # $Source: parser/examples/test_csharp/resfile_summary.cs $# # $Author: villek@matrixscience.com $ # # $Date: 2018-07-30 16:23:53 +0100 $ # # $Revision: 1b450440f9c97e1e41d0fc6016a27d68951d4532 | MSPARSER_REL_2_8_1-0-gea32989045 $ # # $NoKeywords:: $ # ############################################################################## */ using System; using System.Text.RegularExpressions; using matrix_science.msparser; namespace MsParserExamples { public class resfile_summary { public static int Main(string[] argv) { // ----- Object creation ----- if (argv.Length < 1) { Console.WriteLine("Must specify results filename as parameter"); return 1; } int returnValue = 1; //failure ms_mascotresfile file = new ms_mascotresfile(argv[0], 0, ""); if (checkErrors(file)) { /* * The parameters passed to ms_peptidesummary or ms_proteinsummary determine * the type of grouping and the number of proteins and peptides displayed. * Default parameters can be returned using ms_mascotresfile::get_ms_mascotresults_params(). * The return values from this function depend on the type of search, * and also on values in the mascot.dat configuration file if that is available. */ ms_datfile datfile = new ms_datfile("../config/mascot.dat"); //You may need to change this path //if the mascot.dat isn't available, use defaults ms_mascotoptions mascotOptions = new ms_mascotoptions(); if (datfile.isValid()) { mascotOptions = datfile.getMascotOptions(); } uint flags, flags2, minPepLenInPepSummary; int maxHitsToReport; double minProbability, ignoreIonsScoreBelow; bool usePeptideSummary; string scriptName = file.get_ms_mascotresults_params( mascotOptions, out flags, out minProbability, out maxHitsToReport, out ignoreIonsScoreBelow, out minPepLenInPepSummary, out usePeptideSummary, out flags2); bool bResult; if (usePeptideSummary) { /* * For peptide summary * * Flags defined for hierarchical clustering algorithm: * flags: ms_mascotresults::MSRES_CLUSTER_PROTEINS * | ms_mascotresults::MSRES_SHOW_SUBSETS * | ms_mascotresults::MSRES_MUDPIT_PROTEIN_SCORE; * flags2: ms_peptidesummary::MSPEPSUM_USE_HOMOLOGY_THRESH; * * Flags defined for original simple parsimony algorithm: * flags: ms_mascotresults::MSRES_GROUP_PROTEINS | ms_mascotresults::MSRES_SHOW_SUBSETS; */ Console.WriteLine("-------------------------------------------------------------"); Console.WriteLine("--- Peptide summary report ---"); Console.WriteLine("-------------------------------------------------------------"); bResult = showResults(file, usePeptideSummary, flags, minProbability, maxHitsToReport, ignoreIonsScoreBelow, (int)minPepLenInPepSummary, flags2); } else { // Show results from full protein summary, remove grouping flags &= ~(uint)ms_mascotresults.FLAGS.MSRES_GROUP_PROTEINS; flags &= ~(uint)ms_mascotresults.FLAGS.MSRES_SHOW_SUBSETS; Console.WriteLine("-------------------------------------------------------------"); Console.WriteLine("--- Full Protein summary report ---"); Console.WriteLine("-------------------------------------------------------------"); bResult = showResults(file, usePeptideSummary, flags, minProbability, maxHitsToReport, ignoreIonsScoreBelow, (int)minPepLenInPepSummary, flags2); if (bResult && checkErrors(file)) { // Show results from concise protein summary, add grouping flags |= (uint)ms_mascotresults.FLAGS.MSRES_GROUP_PROTEINS; flags |= (uint)ms_mascotresults.FLAGS.MSRES_SHOW_SUBSETS; Console.WriteLine("-------------------------------------------------------------"); Console.WriteLine("--- Concise Protein summary report ---"); Console.WriteLine("-------------------------------------------------------------"); bResult = showResults(file, usePeptideSummary, flags, minProbability, maxHitsToReport, ignoreIonsScoreBelow, (int)minPepLenInPepSummary, flags2); } } if (bResult && checkErrors(file)) { returnValue = 0; //success } } //ms_mascotresults has a reference on ms_mascotresfile, therefore the GC must not delete it too early GC.KeepAlive(file); return returnValue; } private static bool showResults(ms_mascotresfile file, bool pepSum, uint flags, double minProteinProb, int maxHits, double minIonsScore, int minPepLenInPepSummary, uint flags2) { int hit, num_peps, i, query, p, u, family, dbIdx; string accession, description; double mass; ms_mascotresults results; ms_protein prot; ms_peptide pep; if (pepSum) { results = new ms_peptidesummary(file, flags, minProteinProb, maxHits, "", //unigene file minIonsScore, minPepLenInPepSummary, null, flags2); } else { results = new ms_proteinsummary(file, flags, minProteinProb, maxHits, null, null); } if (!checkErrors(file)) { return false; } Console.WriteLine("{0} acid database", ((results.isNA()) ? "Nucleic" : "Amino")); family = 1; // get hit one hit = 1; prot = results.getHit(hit); while (hit <= results.getNumberOfHits()) { accession = prot.getAccession(); dbIdx = prot.getDB(); description = results.getProteinDescription(accession); mass = results.getProteinMass(accession); if ((flags & (uint)ms_mascotresults.FLAGS.MSRES_CLUSTER_PROTEINS) > 0) { Console.WriteLine("Protein Hit {0}.{1}\n===================", hit, family); } else { Console.WriteLine("Protein Hit {0}\n===================", hit); } Console.WriteLine("Accession : {0}", accession); Console.WriteLine("Description : {0}", description); Console.WriteLine("Score : {0:#}", prot.getScore()); Console.WriteLine("Mass : {0}", mass); Console.WriteLine("Frame : {0}", prot.getFrame()); Console.WriteLine("Coverage : {0}", prot.getCoverage()); Console.WriteLine("RMS error : {0}", prot.getRMSDeltas(results)); Console.WriteLine("Peptides : {0}", prot.getNumDisplayPeptides()); // Each protein has a number of peptides that matched - list them num_peps = prot.getNumPeptides(); for (i = 1; i <= num_peps; i++) { query = prot.getPeptideQuery(i); p = prot.getPeptideP(i); if (p != -1 && query != -1 && prot.getPeptideDuplicate(i) != ms_protein.DUPLICATE.DUPE_DuplicateSameQuery) { pep = results.getPeptide(query, p); if (pep != null) { displayPeptideInfo(false, pep, results, prot.getPeptideDuplicate(i) == ms_protein.DUPLICATE.DUPE_Duplicate, prot.getPeptideIsBold(i), prot.getPeptideShowCheckbox(i)); } } } // now display list of all proteins that contained subsets or an identical list of the matching peptides if ((flags & (uint) ms_mascotresults.FLAGS.MSRES_GROUP_PROTEINS) > 0 || (flags & (uint)ms_mascotresults.FLAGS.MSRES_CLUSTER_PROTEINS) > 0) { Console.WriteLine("Proteins matching the same set of peptides:"); i = 1; while ((prot = results.getNextSimilarProteinOf(accession, dbIdx, i)) != null) { string similar_accession = prot.getAccession(); int similar_dbIdx = prot.getDB(); if ((flags & (uint)ms_mascotresults.FLAGS.MSRES_CLUSTER_PROTEINS) > 0 && similar_dbIdx > 1) { Console.Write("{0}::", similar_dbIdx); } Console.WriteLine("{0} Total score: {1:#} Peptides matched: {2}", similar_accession, prot.getScore(), prot.getNumDisplayPeptides()); i++; } if ((flags & ((uint) ms_mascotresults.FLAGS.MSRES_SHOW_SUBSETS)) > 0) { Console.WriteLine("Proteins matching a subset of these peptides:"); i = 1; while ((prot = results.getNextSubsetProteinOf(accession, dbIdx, i)) != null) { string subset_accession = prot.getAccession(); int subset_dbIdx = prot.getDB(); if ((flags & (uint)ms_mascotresults.FLAGS.MSRES_CLUSTER_PROTEINS) > 0 && subset_dbIdx > 1) { Console.Write("{0}::", subset_dbIdx); } Console.WriteLine("{0} Total score: {1:#} Peptides matched: {2}", subset_accession, prot.getScore(), prot.getNumDisplayPeptides()); if ((flags & (uint)ms_mascotresults.FLAGS.MSRES_CLUSTER_PROTEINS) > 0) { int j = 1; if (results.getNextSimilarProteinOf(subset_accession, subset_dbIdx, j) != null) { Console.WriteLine(" Proteins matching the same set of peptides for this subset:"); } ms_protein similar_subset_prot; while ((similar_subset_prot = results.getNextSimilarProteinOf(subset_accession, subset_dbIdx, j)) != null) { string similar_subset_accession = similar_subset_prot.getAccession(); int similar_subset_dbIdx = similar_subset_prot.getDB(); Console.Write(" "); if (similar_subset_dbIdx > 1) { Console.Write("{0}::", similar_subset_dbIdx); } Console.WriteLine("{0} Total score: {1:#} Peptides matched: {2}", similar_subset_accession, similar_subset_prot.getScore(), similar_subset_prot.getNumDisplayPeptides()); j++; } } i++; } } } Console.WriteLine(); Console.WriteLine(); if ((flags & (uint)ms_mascotresults.FLAGS.MSRES_CLUSTER_PROTEINS) > 0) { prot = results.getNextFamilyProtein(hit, family++); if(prot == null) { hit++; prot = results.getHit(hit); family = 1; } } else { hit++; prot = results.getHit(hit); } } results.createUnassignedList(ms_mascotresults.sortBy.SCORE); if (results.getNumberOfUnassigned() > 0) { Console.WriteLine("Unassigned list"); Console.WriteLine("---------------"); for (u = 1; u <= results.getNumberOfUnassigned(); u++) { pep = results.getUnassigned(u); displayPeptideInfo(false, pep, results, false, true, true); } } if (pepSum) displayYellowPopupInfo(results, 1); return true; } //method private static void displayYellowPopupInfo(ms_mascotresults results, int queryNo) { int p; ms_peptide pep; String seq, tmp, hit, protein, morethan = ""; Regex regex = new Regex(@"(\d):([^ ]*)[ ]*(.*)"); Console.WriteLine("Score Delta Hit Protein Peptide"); for (p = 1; p <= 10; p++) { if ((pep = results.getPeptide(queryNo, p)) != null) { seq = pep.getPeptideStr(); if (seq.Length > 0) { tmp = results.getProteinsWithThisPepMatch(queryNo, p, true); hit = " "; protein = " "; morethan = ""; if (tmp.Length > 0) { if (regex.IsMatch(tmp)) { Match OneMatch = regex.Match(tmp); if (OneMatch.Success) { int groupCount = OneMatch.Groups.Count; if (groupCount >= 2) hit = OneMatch.Groups[1].Value; if (groupCount >= 3) protein = OneMatch.Groups[2].Value; if (groupCount >= 4) morethan = OneMatch.Groups[3].Value; } } if (morethan.Length > 0) { hit = hit+"+"; } } Console.WriteLine("{0} {1} {2} {3} {4}", pep.getIonsScore(), pep.getDelta(), hit, protein, pep.getPeptideStr()); } } } p = 1; Console.WriteLine("Accessions that matched query {0} rank {1}:- {2}", queryNo, p, results.getProteinsWithThisPepMatch(queryNo, p, false)); } //method private static void displayPeptideInfo(bool showFullDetails, ms_peptide p, ms_mascotresults r, bool isDuplicate, bool isBold, bool showCheckBox) { int q = p.getQuery(); if (showFullDetails) { Console.WriteLine("Peptide hit"); if (p.getAnyMatch()) { Console.WriteLine(" Query : {0}", q); Console.WriteLine(" Rank : {0}", p.getRank()); Console.WriteLine(" Matched : {0}", p.getAnyMatch()); Console.WriteLine(" missedCleave: {0}", p.getMissedCleavages()); Console.WriteLine(" mrCalc : {0}", p.getMrCalc()); Console.WriteLine(" delta : {0}", p.getDelta()); Console.WriteLine(" observed : {0}", p.getObserved()); Console.WriteLine(" charge : {0}", p.getCharge()); Console.WriteLine(" mrExp : {0}", p.getMrExperimental()); Console.WriteLine(" ionsMatched : {0}", p.getNumIonsMatched()); Console.WriteLine(" peptideStr : {0}", p.getPeptideStr()); Console.WriteLine(" peaksUsed1 : {0}", p.getPeaksUsedFromIons1()); Console.WriteLine(" varModsStr : {0}", p.getVarModsStr()); Console.WriteLine(" readable mod: {0}", r.getReadableVarMods(q, p.getRank(), 2)); Console.WriteLine(" ionsScore : {0}", p.getIonsScore()); Console.WriteLine(" seriesUsedS : {0}", p.getSeriesUsedStr()); Console.WriteLine(" peaksUsed2 : {0}", p.getPeaksUsedFromIons2()); Console.WriteLine(" peaksUsed3 : {0}", p.getPeaksUsedFromIons3()); Console.WriteLine(" idth, hth, p: {0}, {1}, {2}", r.getPeptideIdentityThreshold(q, 20), r.getHomologyThreshold(q, 20), r.getProbOfPepBeingRandomMatch(p.getIonsScore(), q)); Console.WriteLine(); } else { Console.WriteLine(" No match"); } } else { if (showCheckBox) Console.Write("CB "); else Console.Write("-- "); if (isBold) Console.Write("BOLD "); else Console.Write("dim "); Console.Write(q.ToString().PadLeft(4)); Console.Write(" "); double observed = p.getObserved(); Console.Write(" "); Console.Write(string.Format("{0}", observed.ToString("0.000000")).PadLeft(11)); Console.Write(" "); Console.Write(p.getRank().ToString().PadLeft(4)); Console.Write("({0})", p.getPrettyRank().ToString().PadLeft(4)); Console.Write(" "); Console.Write(p.getPeptideStr().ToString().PadLeft(20)); Console.Write(" "); double score = p.getIonsScore(); Console.Write(string.Format("{0}{1}{2}", (isDuplicate) ? "(" : "", score.ToString("0.00"), (isDuplicate) ? ")" : "").PadLeft(8)); Console.Write(" "); if (r.getReadableVarMods(q, p.getRank(), 2).Length == 0) Console.WriteLine(" 0"); else { string let = r.getReadableVarMods(q, p.getRank(), 2).Substring(0, 1); int iLet; if (int.TryParse(let, out iLet)) { Console.WriteLine(" {0}", iLet); } else Console.WriteLine(" 0"); } } } //method private static bool checkErrors(ms_mascotresfile file) { for (int loop = 1; loop <= file.getNumberOfErrors(); loop++) { Console.WriteLine("Error number: {0} : {1}", file.getErrorNumber(loop), file.getErrorString(loop)); } // Call isValid before clearAllErrors, otherwise this method always returns true bool isValid = file.isValid(); file.clearAllErrors(); return isValid; } //method } //class } //namespace /* resfile_summary.exe c:\inetpub\mascot\data\F981123.dat Will give the following output: ------------------------------------------------------------- --- Peptide summary report --- ------------------------------------------------------------- Amino acid database Protein Hit 1 =================== Accession : CH60_HUMAN Description : 60 kDa heat shock protein, mitochondrial OS=Homo sapiens GN=HSPD1 PE=1 SV=2 Score : 1225 Mass : 61016.38 Frame : 0 Coverage : 283 RMS error : 30.4200726378481 Peptides : 31 CB BOLD 11 417.182190 1( 1) APGFGDNR 45.35 0 CB BOLD 12 422.743286 1( 1) VGEVIVTK 45.74 0 CB BOLD 13 430.732788 1( 1) IPAMTIAK 36.27 0 CB BOLD 15 451.249908 1( 1) LSDGVAVLK 51.95 0 CB BOLD 16 456.780609 1( 1) VGLQVVAVK 59.00 0 CB BOLD 21 480.744690 1( 1) VTDALNATR 45.33 0 CB BOLD 24 595.785522 1( 1) EIGNIISDAMK (56.55) 0 CB BOLD 25 603.771973 1( 1) EIGNIISDAMK 59.52 0 CB BOLD 26 608.309875 1( 1) NAGVEGSLIVEK 73.21 0 CB BOLD 27 617.285706 1( 1) VGGTSDVEVNEK 80.63 0 CB BOLD 31 672.837524 1( 1) TVIIEQSWGSPK 64.38 0 CB BOLD 34 714.888428 1( 1) GVMLAVDAVIAELK (64.52) 0 CB BOLD 35 714.893799 1( 1) GVMLAVDAVIAELK (72.61) 0 CB BOLD 36 722.884888 1( 1) GVMLAVDAVIAELK 75.19 0 CB BOLD 37 722.893372 1( 1) GVMLAVDAVIAELK (72.57) 0 CB BOLD 39 752.864319 1( 1) TLNDELEIIEGMK 89.56 0 CB BOLD 40 760.846130 1( 1) TLNDELEIIEGMK (88.82) 0 CB BOLD 45 640.328125 1( 1) ISSIQSIVPALEIANAHR 101.50 0 CB BOLD 46 960.032715 1( 1) ISSIQSIVPALEIANAHR (87.34) 0 CB BOLD 48 1019.510620 1( 1) IQEIIEQLDVTTSEYEK 52.42 0 CB BOLD 51 1057.053711 1( 1) ALMLQGVDLLADAVAVTMGPK 115.78 0 CB BOLD 52 1065.039917 1( 1) ALMLQGVDLLADAVAVTMGPK (71.79) 0 CB BOLD 53 1065.062256 1( 1) ALMLQGVDLLADAVAVTMGPK (26.17) 0 CB BOLD 54 1073.047729 1( 1) ALMLQGVDLLADAVAVTMGPK (92.82) 2 CB BOLD 58 789.106201 1( 1) KPLVIIAEDVDGEALSTLVLNR (55.53) 0 CB BOLD 59 1183.156982 1( 1) KPLVIIAEDVDGEALSTLVLNR (65.46) 0 CB BOLD 60 789.109375 1( 1) KPLVIIAEDVDGEALSTLVLNR 94.59 0 CB BOLD 61 828.123779 1( 1) TALLDAAGVASLLTTAEVVVTEIPK (26.50) 0 CB BOLD 62 828.132202 1( 1) TALLDAAGVASLLTTAEVVVTEIPK 47.53 0 CB BOLD 64 854.058777 1( 1) LVQDVANNTNEEAGDGTTTATVLAR 75.15 0 CB BOLD 65 1038.503052 1( 1) DMAIATGGAVFGEEGLTLNLEDVQPHDLGK 13.05 0 Proteins matching the same set of peptides: Proteins matching a subset of these peptides: CH60_PONAB Total score: 1008 Peptides matched: 25 CH60_CRIGR Total score: 951 Peptides matched: 23 CH60_MOUSE Total score: 951 Peptides matched: 23 CH60_RAT Total score: 951 Peptides matched: 23 CH60_BOVIN Total score: 918 Peptides matched: 22 CH60_CHICK Total score: 876 Peptides matched: 19 CH60_MESAU Total score: 664 Peptides matched: 18 CH60C_DROME Total score: 121 Peptides matched: 2 CH60C_ARATH Total score: 91 Peptides matched: 2 HSP60_CANAL Total score: 45 Peptides matched: 1 HSP60_EMENI Total score: 45 Peptides matched: 1 HSP60_PARBA Total score: 45 Peptides matched: 1 HSP60_YEAST Total score: 45 Peptides matched: 1 CH602_VIBPA Total score: 45 Peptides matched: 1 CH602_VIBVU Total score: 45 Peptides matched: 1 CH602_VIBVY Total score: 45 Peptides matched: 1 CH60_EUGGR Total score: 45 Peptides matched: 1 Protein Hit 2 =================== Accession : CH60_DROME Description : 60 kDa heat shock protein, mitochondrial OS=Drosophila melanogaste r GN=Hsp60 PE=1 SV=3 Score : 174 Mass : 60770.89 Frame : 0 Coverage : 67 RMS error : 29.5905072791318 Peptides : 4 -- dim 11 417.182190 1( 1) APGFGDNR 45.35 0 -- dim 27 617.285706 2( 2) VGGSSEVEVNEK 41.69 0 -- dim 59 1183.156982 2( 2) KPLVIIAEDIDGEALSTLVVNR 12.20 0 -- dim 64 854.058777 1( 1) LVQDVANNTNEEAGDGTTTATVLAR 75.15 0 Proteins matching the same set of peptides: Proteins matching a subset of these peptides: HSP60_SCHPO Total score: 87 Peptides matched: 2 Protein Hit 3 =================== Accession : CH60_CAEEL Description : Chaperonin homolog Hsp-60, mitochondrial OS=Caenorhabditis elegans GN=hsp-60 PE=1 SV=2 Score : 135 Mass : 60063.75 Frame : 0 Coverage : 21 RMS error : 36.5383063193603 Peptides : 3 -- dim 11 417.182190 1( 1) APGFGDNR 45.35 0 -- dim 39 752.864319 2( 1) TLNDELELIEGMK 89.56 0 -- dim 40 760.846130 2( 1) TLNDELELIEGMK (88.82) 0 Proteins matching the same set of peptides: Proteins matching a subset of these peptides: Protein Hit 4 =================== Accession : CH60_STRM5 Description : 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain R551-3) GN=groL PE=3 SV=1 Score : 42 Mass : 57311.84 Frame : 0 Coverage : 9 RMS error : 76.92376960617 Peptides : 1 -- dim 16 456.780609 2( 2) GIVKVVAVK 42.20 0 Proteins matching the same set of peptides: CH60_STRMK Total score: 42 Peptides matched: 1 CH60_XANAC Total score: 42 Peptides matched: 1 CH60_XANC5 Total score: 42 Peptides matched: 1 CH60_XANC8 Total score: 42 Peptides matched: 1 CH60_XANCB Total score: 42 Peptides matched: 1 CH60_XANCH Total score: 42 Peptides matched: 1 CH60_XANCP Total score: 42 Peptides matched: 1 CH60_XANOM Total score: 42 Peptides matched: 1 CH60_XANOP Total score: 42 Peptides matched: 1 CH60_XANOR Total score: 42 Peptides matched: 1 Proteins matching a subset of these peptides: Protein Hit 5 =================== Accession : NMDE4_HUMAN Description : Score : 37 Mass : 0 Frame : 0 Coverage : 10 RMS error : 9.41906700790969 Peptides : 1 -- dim 16 456.780609 3( 3) VAAGVAVVAR 37.24 0 Proteins matching the same set of peptides: NMDE4_MOUSE Total score: 37 Peptides matched: 1 NMDE4_RAT Total score: 36 Peptides matched: 1 Proteins matching a subset of these peptides: Protein Hit 6 =================== Accession : YF81_THET2 Description : Score : 35 Mass : 0 Frame : 0 Coverage : 9 RMS error : 37.0214184966023 Peptides : 1 -- dim 16 456.780609 4( 4) VAQVLGVVK 34.76 0 Proteins matching the same set of peptides: Y1944_THET8 Total score: 35 Peptides matched: 1 Proteins matching a subset of these peptides: Protein Hit 7 =================== Accession : F4ST_FLACH Description : Score : 34 Mass : 0 Frame : 0 Coverage : 9 RMS error : 87.8815544838649 Peptides : 1 -- dim 15 451.249908 2( 2) LSATGLVLK 33.85 0 Proteins matching the same set of peptides: Proteins matching a subset of these peptides: Protein Hit 8 =================== Accession : ZN711_HUMAN Description : Zinc finger protein 711 OS=Homo sapiens GN=ZNF711 PE=1 SV=2 Score : 31 Mass : 86190.24 Frame : 0 Coverage : 13 RMS error : 69.4028633218151 Peptides : 1 CB BOLD 33 714.364929 1( 1) EASPLSSNKLILR 30.84 0 Proteins matching the same set of peptides: ZN711_MOUSE Total score: 31 Peptides matched: 1 Proteins matching a subset of these peptides: Unassigned list --------------- CB BOLD 14 442.228302 1( 1) IAIRGLLK 28.47 0 CB BOLD 22 1101.536621 1( 1) ITVSTSGLVPK 14.40 0 CB BOLD 9 747.396179 1( 1) DAEDVAK 13.59 0 CB BOLD 23 1101.621704 1( 1) QLLMVAGVDR 12.04 0 CB BOLD 8 714.372498 1( 1) LAPAQSK 10.69 0 CB BOLD 4 662.275574 1( 1) AGNAVCK 9.73 0 CB BOLD 30 663.837891 1( 1) AQLLEINEKLR 9.54 0 CB BOLD 57 747.036072 1( 1) AMWRLVDEMVQDGFPTTAR 9.05 0 CB BOLD 55 1099.094727 1( 1) LNAEAVRTLLSANGQKPSEAK 8.05 0 CB BOLD 29 642.353577 1( 1) VVGVAGQGASALVR 7.91 0 CB BOLD 6 673.349487 1( 1) AVLGGTR 7.59 0 CB BOLD 28 642.352600 1( 1) KNVSVSQGPDPR 7.22 0 CB BOLD 38 749.383972 1( 1) QSTMQRSAAGTSTR 7.10 0 CB BOLD 50 1048.561523 1( 1) ALDEILEYQNYPVVCAKK 5.70 0 CB BOLD 49 1020.987915 1( 1) VEPPGDKTLKPGPGAHSPEK 5.49 0 CB BOLD 19 932.364380 1( 1) MHNLMDR 4.61 0 CB BOLD 20 933.499023 1( 1) SRDPGMVR 3.21 0 CB BOLD 47 665.009583 1( 1) QTLQVFKYYLMDENGK 2.25 0 CB BOLD 41 886.405884 1( 1) AGLELADSPVTPEMLGR 1.93 0 CB BOLD 18 930.703003 1( 1) ASRAQLER 1.60 0 CB BOLD 7 711.364685 1( 1) GGAHEIK 1.34 0 CB BOLD 32 711.370728 1( 1) DKAIGYTSCGNHR 1.20 0 CB BOLD 17 930.683105 1( 1) KIQAEITK 1.00 0 CB BOLD 44 949.550720 1( 1) LAARWLAEHPHAPSSVR 0.76 0 CB BOLD 43 933.003784 1( 1) ISATCVPSAVQKWFAEK 0.70 0 CB BOLD 1 498.272888 1( 1) 0.00 0 CB BOLD 2 500.256012 1( 1) 0.00 0 CB BOLD 3 575.558411 1( 1) 0.00 0 CB BOLD 5 662.417175 1( 1) 0.00 0 CB BOLD 10 747.412476 1( 1) 0.00 0 CB BOLD 42 932.460815 1( 1) 0.00 0 CB BOLD 56 1119.045166 1( 1) 0.00 0 CB BOLD 63 832.798584 1( 1) 0.00 0 CB BOLD 66 1113.894653 1( 1) 0.00 0 CB BOLD 67 1116.177490 1( 1) 0.00 0 Score Delta Hit Protein Peptide Accessions that matched query 97 rank 1:- */
Copyright © 2022 Matrix Science Ltd. All Rights Reserved. Generated on Thu Mar 31 2022 01:12:29 |