Example program for extracting the peptide or protein summary.
#!/usr/local/bin/perl
##############################################################################
# file: resfile_summary.pl #
# 'msparser' toolkit #
# Test harness / example code #
##############################################################################
# COPYRIGHT NOTICE #
# Copyright 1998-2016 Matrix Science Limited All Rights Reserved. #
# #
##############################################################################
# $Source: parser/examples/test_perl/resfile_summary.pl $ #
# $Author: villek@matrixscience.com $ #
# $Date: 2018-07-30 16:23:53 +0100 $ #
# $Revision: 1b450440f9c97e1e41d0fc6016a27d68951d4532 | MSPARSER_REL_2_8_1-0-gea32989045 $ #
# $NoKeywords:: $ #
##############################################################################
use strict;
##############################################################################
use msparser;
if (!defined($ARGV[0])) { die "Must specify results filename as parameter"; }
my $returnValue = 1;
my $resfile = new msparser::ms_mascotresfile($ARGV[0]);
if (checkErrors($resfile)) {
# The parameters passed to ms_peptidesummary or ms_proteinsummary determine
# the type of grouping and the number of proteins and peptides displayed.
# Default parameters can be returned using ms_mascotresfile::get_ms_mascotresults_params().
# The return values from this function depend on the type of search,
# and also on values in the mascot.dat configuration file if that is available.
my $datfile = new msparser::ms_datfile("../config/mascot.dat"); # You may need to change this path
# if the mascot.dat isn't available, use defaults
my $mascotOptions;
if ($datfile->isValid()) {
$mascotOptions = $datfile->getMascotOptions();
}
my ($scriptName,
$flags,
$minProbability,
$maxHitsToReport,
$ignoreIonsScoreBelow,
$minPepLenInPepSummary,
$usePeptideSummary,
$flags2
) = $resfile->get_ms_mascotresults_params($datfile->getMascotOptions);
my $bResult;
if ($usePeptideSummary) {
# For peptide summary
#
# Flags defined for hierarchical clustering algorithm:
# flags: ms_mascotresults::MSRES_CLUSTER_PROTEINS
# | ms_mascotresults::MSRES_SHOW_SUBSETS
# | ms_mascotresults::MSRES_MUDPIT_PROTEIN_SCORE;
# flags2: ms_peptidesummary::MSPEPSUM_USE_HOMOLOGY_THRESH;
#
# Flags defined for original simple parsimony algorithm:
# flags: ms_mascotresults::MSRES_GROUP_PROTEINS | ms_mascotresults::MSRES_SHOW_SUBSETS;
print "-------------------------------------------------------------\n";
print "--- Peptide summary report ---\n";
print "-------------------------------------------------------------\n";
$bResult = show_results(
$resfile,
$usePeptideSummary,
$flags,
$minProbability,
$maxHitsToReport,
$ignoreIonsScoreBelow,
$minPepLenInPepSummary,
$flags2
);
} else {
# Show results from full protein summary, remove grouping
$flags &= ~$msparser::ms_mascotresults::MSRES_GROUP_PROTEINS;
$flags &= ~$msparser::ms_mascotresults::MSRES_SHOW_SUBSETS;
print "-------------------------------------------------------------\n";
print "--- Full Protein summary report ---\n";
print "-------------------------------------------------------------\n";
$bResult = show_results(
$resfile,
$usePeptideSummary,
$flags,
$minProbability,
$maxHitsToReport,
$ignoreIonsScoreBelow,
$minPepLenInPepSummary,
$flags2
);
if($bResult and checkErrors($resfile)) {
# Show results from concise protein summary, add grouping
$flags |= $msparser::ms_mascotresults::MSRES_GROUP_PROTEINS;
$flags |= $msparser::ms_mascotresults::MSRES_SHOW_SUBSETS;
print "-------------------------------------------------------------\n";
print "--- Concise Protein summary report ---\n";
print "-------------------------------------------------------------\n";
$bResult = show_results(
$resfile,
$usePeptideSummary,
$flags,
$minProbability,
$maxHitsToReport,
$ignoreIonsScoreBelow,
$minPepLenInPepSummary,
$flags2
);
}
}
if($bResult and checkErrors($resfile)) {
$returnValue = 0;
}
}
exit($returnValue);
##############################################################################
# show_results #
# - parameter 0 is ms_mascotresfile #
# - parameter 1 is true for peptide summary, false for protein #
# - parameter 2 is the flags for display #
# - parameter 3 is the minimum protein probability to display #
# - parameter 4 is the maximum number of hits to display #
# - parameter 5 is the minimum ions score to use #
# - parameter 6 is the minPepLenInPepSummary to use #
##############################################################################
sub show_results {
my($file, $usePeptideSummary, $flags, $minProteinProb, $maxHits,
$minIonsScore, $minPepLenInPepSummary, $flags2) = @_;
my $results;
if ($usePeptideSummary) {
$results = new msparser::ms_peptidesummary(
$file, $flags, $minProteinProb, $maxHits, "", $minIonsScore, $minPepLenInPepSummary, "", $flags2
);
} else {
$results = new msparser::ms_proteinsummary(
$file, $flags, $minProteinProb, $maxHits
);
}
# Stop there is any fatal error occurred
if (not checkErrors($file)) {
return 0;
}
my $family = 1;
my $hit = 1;
my $prot = $results->getHit($hit);
while ($prot) {
my $accession = $prot->getAccession();
my $description = $results->getProteinDescription($accession);
my $mass = $results->getProteinMass($accession);
my $dbIdx = $prot->getDB();
if ($flags & $msparser::ms_mascotresults::MSRES_CLUSTER_PROTEINS) {
print "Protein Hit ", $hit, ".", $family, "\n===================\n";
}
else {
print "Protein Hit ", $hit, "\n===================\n";
}
print "Accession : " , $accession, "\n";
print "Description : " , $description , "\n";
print "Score : " , $prot->getScore() , "\n";
print "Mass : " , $mass , "\n";
print "Frame : " , $prot->getFrame() , "\n";
print "Coverage : " , $prot->getCoverage() , "\n";
print "RMS error : " , $prot->getRMSDeltas($results), "\n";
print "Peptides : " , $prot->getNumDisplayPeptides(),"\n";
# Each protein has a number of peptides that matched - list them:
my $num_peps = $prot->getNumPeptides();
for my $i (1 .. $num_peps) {
my $query = $prot->getPeptideQuery($i);
my $p = $prot->getPeptideP($i);
if (
$p != -1
and $query != -1
and $prot->getPeptideDuplicate($i) != $msparser::ms_protein::DUPE_DuplicateSameQuery
) {
my $pep = $results->getPeptide($query, $p);
next unless defined $pep;
displayPeptideInfo(
0, $pep, $results,
$prot->getPeptideDuplicate($i) == $msparser::ms_protein::DUPE_Duplicate,
$prot->getPeptideIsBold($i),
$prot->getPeptideShowCheckbox($i)
);
}
}
# Now display list of all proteins that contained subsets or and
# identical list of the matching peptides
if ($flags & $msparser::ms_mascotresults::MSRES_GROUP_PROTEINS or
$flags & $msparser::ms_mascotresults::MSRES_CLUSTER_PROTEINS) {
print "Proteins matching the same set of peptides:\n";
my $i = 1;
while (my $prot = $results->getNextSimilarProteinOf($accession, $dbIdx, $i)) {
my $accession = $prot->getAccession();
my $dbIdx = $prot->getDB();
if($flags & $msparser::ms_mascotresults::MSRES_CLUSTER_PROTEINS and $dbIdx > 1) {
print $dbIdx, "::";
}
print $accession, " - Total score: ", $prot->getScore();
print " - Peptides matched: ", $prot->getNumDisplayPeptides(), "\n";
$i++;
}
if ($flags & $msparser::ms_mascotresults::MSRES_SHOW_SUBSETS) {
print "Proteins matching a subset of these peptides:\n";
my $i = 1;
while ($prot = $results->getNextSubsetProteinOf($accession, $dbIdx, $i)) {
my $accession = $prot->getAccession();
my $dbIdx = $prot->getDB();
if($flags & $msparser::ms_mascotresults::MSRES_CLUSTER_PROTEINS and $dbIdx > 1) {
print $dbIdx, "::";
}
print $accession, " - Total score: ", $prot->getScore();
print " - Peptides matched: ", $prot->getNumDisplayPeptides(), "\n";
if ($flags & $msparser::ms_mascotresults::MSRES_CLUSTER_PROTEINS) {
my $j = 1;
if($results->getNextSimilarProteinOf($accession, $dbIdx, $j)){
print " Proteins matching the same set of peptides for this subset:\n";
}
while (my $similar_subset_prot = $results->getNextSimilarProteinOf($accession, $dbIdx, $j)) {
my $similar_subset_accession = $similar_subset_prot->getAccession();
my $similar_subset_dbIdx = $similar_subset_prot->getDB();
print " ";
if($similar_subset_dbIdx > 1) {
print $similar_subset_dbIdx, "::";
}
print $similar_subset_accession, " - Total score: ", $similar_subset_prot->getScore();
print " - Peptides matched: ", $similar_subset_prot->getNumDisplayPeptides(), "\n";
$j++;
}
}
$i++;
}
}
}
if ($flags & $msparser::ms_mascotresults::MSRES_CLUSTER_PROTEINS) {
$prot = $results->getNextFamilyProtein($hit, $family++);
if(!$prot) {
$hit++;
$prot = $results->getHit($hit);
$family = 1;
}
}
else {
$hit++;
$prot = $results->getHit($hit);
}
print "\n";
}
$results->createUnassignedList($msparser::ms_mascotresults::SCORE);
if ($results->getNumberOfUnassigned()) {
print "Unassigned list\n";
print "---------------\n";
for my $u (1 .. $results->getNumberOfUnassigned) {
my $pep = $results->getUnassigned($u);
displayPeptideInfo(0, $pep, $results, 0, 1, 1);
}
}
if ($usePeptideSummary) {
print "\n";
displayYellowPopupInfo($results, 1);
}
return 1;
}
##############################################################################
# displayYellowPopupInfo #
# Shows the equivalent of the yellow popup box for given query #
# - parameter 0 is the results object #
# - parameter 1 is the query number #
##############################################################################
sub displayYellowPopupInfo {
my ($results, $q) = @_;
my $fmt = "%5s %5s %9s %7s %7s\n";
printf $fmt, qw(Score Delta Hit Protein Peptide);
for my $p (1 .. 10) {
my $pep = $results->getPeptide($q, $p);
next unless defined $pep;
my $seq = $pep->getPeptideStr();
next unless defined $seq;
my $tmp = $results->getProteinsWithThisPepMatch($q, $p);
my ($hit, $protein) = ('', '');
if ($tmp) {
($hit, $protein, my $morethan) = $tmp =~ /(\d+):([^ ]*)[ ]*(.*)/;
if ($morethan) {
$hit .= "+";
}
}
printf $fmt, $pep->getIonsScore(), $pep->getDelta(), $hit, $protein, $seq;
}
my $p = 1;
print "Accessions that matched query ", $q, " rank ", $p, ":- ",
$results->getProteinsWithThisPepMatch($q, $p), "\n";
}
##############################################################################
# displayPeptideInfo #
# - parameter 0 showFullDetails? #
# - parameter 1 p #
# - parameter 2 ms_mascotresults #
# - parameter 3 isDuplicate? #
# - parameter 4 isBold? #
# - parameter 5 showCheckBox? #
##############################################################################
sub displayPeptideInfo {
my ($showFullDetails, $p, $r, $isDuplicate, $isBold, $showCheckBox) = @_;
my $q = $p->getQuery();
if (!$showFullDetails) {
my $fmt = "%2s %4s %4d %11f %4d(%4d) %-20s %s%3.2f%s %3d\n";
printf $fmt,
$showCheckBox ? "CB" : "--",
$isBold ? "BOLD" : "dim",
$q,
$p->getObserved,
$p->getRank,
$p->getPrettyRank,
$p->getPeptideStr,
$isDuplicate ? '(' : '',
$p->getIonsScore,
$isDuplicate ? ')' : '',
$r->getReadableVarMods($q, $p->getRank),
;
return;
}
print "Peptide hit\n";
if ($p->getAnyMatch()) {
my $fmt = " %-12s: %s\n";
printf $fmt, 'Query' , $q;
printf $fmt, 'Rank' , $p->getRank;
printf $fmt, 'Matched' , $p->getAnyMatch;
printf $fmt, 'missedCleave', $p->getMissedCleavages;
printf $fmt, 'mrCalc' , $p->getMrCalc;
printf $fmt, 'delta' , $p->getDelta;
printf $fmt, 'observed' , $p->getObserved;
printf $fmt, 'charge' , $p->getCharge;
printf $fmt, 'mrExp' , $p->getMrExperimental;
printf $fmt, 'ionsMatched' , $p->getNumIonsMatched;
printf $fmt, 'peptideStr' , $p->getPeptideStr;
printf $fmt, 'peaksUsed1' , $p->getPeaksUsedFromIons1;
printf $fmt, 'varModsStr' , $p->getVarModsStr;
printf $fmt, 'readable mod', $r->getReadableVarMods($q, $p->getRank);
printf $fmt, 'ionsScore' , $p->getIonsScore;
printf $fmt, 'seriesUsedS' , $p->getSeriesUsedStr;
printf $fmt, 'peaksUsed2' , $p->getPeaksUsedFromIons3;
printf $fmt, 'peaksUsed3' , $p->getPeaksUsedFromIons3;
printf $fmt, 'idth, hth, p', join(', ',
$r->getPeptideIdentityThreshold($q, 20),
$r->getHomologyThreshold($q, 20),
$r->getProbOfPepBeingRandomMatch($p->getIonsScore, $q)
);
print "\n";
} else {
print " No match\n";
}
}
##############################################################################
# checkErrors #
# - parameter 0 file is a ms_mascotresfile #
##############################################################################
sub checkErrors() {
my ($file) = @_;
if ($file->getLastError()) {
for my $i (1 .. $file->getNumberOfErrors) {
print "Error number: ", $file->getErrorNumber($i);
print " : ", $file->getErrorString($i);
print "\n";
}
}
#Call isValid before clearAllErrors, otherwise this method always returns true
my $bIsValid = $file->isValid();
$file->clearAllErrors();
return $bIsValid;
}
=pod
Running the program as
perl -I../bin resfile_summary.pl ../data/F981123.dat
will give the following output under Mascot Server 2.3:
-------------------------------------------------------------
--- Peptide summary report ---
-------------------------------------------------------------
Protein Hit 1
===================
Accession : CH60_HUMAN
Description : 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock
Score : 1225.18623376928
Mass : 61016.38
Frame : 0
Coverage : 283
RMS error : 30.4200726378481
Peptides : 31
CB BOLD 11 417.182190 1( 1) APGFGDNR 45.35 0
CB BOLD 12 422.743286 1( 1) VGEVIVTK 45.74 0
CB BOLD 13 430.732788 1( 1) IPAMTIAK 36.27 0
CB BOLD 15 451.249908 1( 1) LSDGVAVLK 51.95 0
CB BOLD 16 456.780609 1( 1) VGLQVVAVK 59.00 0
CB BOLD 21 480.744690 1( 1) VTDALNATR 45.33 0
CB BOLD 24 595.785522 1( 1) EIGNIISDAMK (56.55) 0
CB BOLD 25 603.771973 1( 1) EIGNIISDAMK 59.52 0
CB BOLD 26 608.309875 1( 1) NAGVEGSLIVEK 73.21 0
CB BOLD 27 617.285706 1( 1) VGGTSDVEVNEK 80.63 0
CB BOLD 31 672.837524 1( 1) TVIIEQSWGSPK 64.38 0
CB BOLD 34 714.888428 1( 1) GVMLAVDAVIAELK (64.52) 0
CB BOLD 35 714.893799 1( 1) GVMLAVDAVIAELK (72.61) 0
CB BOLD 36 722.884888 1( 1) GVMLAVDAVIAELK 75.19 0
CB BOLD 37 722.893372 1( 1) GVMLAVDAVIAELK (72.57) 0
CB BOLD 39 752.864319 1( 1) TLNDELEIIEGMK 89.56 0
CB BOLD 40 760.846130 1( 1) TLNDELEIIEGMK (88.82) 0
CB BOLD 45 640.328125 1( 1) ISSIQSIVPALEIANAHR 101.50 0
CB BOLD 46 960.032715 1( 1) ISSIQSIVPALEIANAHR (87.34) 0
CB BOLD 48 1019.510620 1( 1) IQEIIEQLDVTTSEYEK 52.42 0
CB BOLD 51 1057.053711 1( 1) ALMLQGVDLLADAVAVTMGPK 115.78 0
CB BOLD 52 1065.039917 1( 1) ALMLQGVDLLADAVAVTMGPK (71.79) 0
CB BOLD 53 1065.062256 1( 1) ALMLQGVDLLADAVAVTMGPK (26.17) 0
CB BOLD 54 1073.047729 1( 1) ALMLQGVDLLADAVAVTMGPK (92.82) 2
CB BOLD 58 789.106201 1( 1) KPLVIIAEDVDGEALSTLVLNR (55.53) 0
CB BOLD 59 1183.156982 1( 1) KPLVIIAEDVDGEALSTLVLNR (65.46) 0
CB BOLD 60 789.109375 1( 1) KPLVIIAEDVDGEALSTLVLNR 94.59 0
CB BOLD 61 828.123779 1( 1) TALLDAAGVASLLTTAEVVVTEIPK (26.50) 0
CB BOLD 62 828.132202 1( 1) TALLDAAGVASLLTTAEVVVTEIPK 47.53 0
CB BOLD 64 854.058777 1( 1) LVQDVANNTNEEAGDGTTTATVLAR 75.15 0
CB BOLD 65 1038.503052 1( 1) DMAIATGGAVFGEEGLTLNLEDVQPHDLGK 13.05 0
Proteins matching the same set of peptides:
Proteins matching a subset of these peptides:
CH60_PONPY Total score: 1007.90623376928 Peptides matched: 25
CH60_CRIGR Total score: 951.166233769285 Peptides matched: 23
CH60_MOUSE Total score: 951.166233769285 Peptides matched: 23
CH60_RAT Total score: 951.166233769285 Peptides matched: 23
CH60_BOVIN Total score: 917.68246753857 Peptides matched: 22
CH60_CHICK Total score: 875.976233769285 Peptides matched: 19
CH60C_DROME Total score: 120.5 Peptides matched: 2
CH60C_ARATH Total score: 90.68 Peptides matched: 2
HSP60_CANAL Total score: 45.35 Peptides matched: 1
HSP60_PARBR Total score: 45.35 Peptides matched: 1
HSP60_YEAST Total score: 45.35 Peptides matched: 1
CH602_VIBPA Total score: 45.35 Peptides matched: 1
CH602_VIBVU Total score: 45.35 Peptides matched: 1
CH602_VIBVY Total score: 45.35 Peptides matched: 1
CH60_EUGGR Total score: 45.33 Peptides matched: 1
Protein Hit 2
===================
Accession : CH60_DROME
Description : 60 kDa heat shock protein, mitochondrial precursor (Hsp60) (60 kDa chaperonin) (CPN60) (Heat shock
Score : 174.39
Mass : 60770.89
Frame : 0
Coverage : 67
RMS error : 29.5905072791318
Peptides : 4
-- dim 11 417.182190 1( 1) APGFGDNR 45.35 0
-- dim 27 617.285706 2( 2) VGGSSEVEVNEK 41.69 0
-- dim 59 1183.156982 2( 2) KPLVIIAEDIDGEALSTLVVNR 12.20 0
-- dim 64 854.058777 1( 1) LVQDVANNTNEEAGDGTTTATVLAR 75.15 0
Proteins matching the same set of peptides:
Proteins matching a subset of these peptides:
HSP60_SCHPO Total score: 87.04 Peptides matched: 2
Protein Hit 3
===================
Accession : CH60_CAEEL
Description : Chaperonin homolog Hsp-60, mitochondrial precursor (Heat shock protein 60) (HSP-60) - Caenorhabditi
Score : 134.91
Mass : 60063.75
Frame : 0
Coverage : 21
RMS error : 36.5383063193603
Peptides : 3
-- dim 11 417.182190 1( 1) APGFGDNR 45.35 0
-- dim 39 752.864319 2( 1) TLNDELELIEGMK 89.56 0
-- dim 40 760.846130 2( 1) TLNDELELIEGMK (88.82) 0
Proteins matching the same set of peptides:
Proteins matching a subset of these peptides:
Protein Hit 4
===================
Accession : CH60_XANAC
Description : 60 kDa chaperonin (Protein Cpn60) (groEL protein) - Xanthomonas axonopodis pv. citri
Score : 42.2
Mass : 57130.83
Frame : 0
Coverage : 9
RMS error : 76.92376960617
Peptides : 1
-- dim 16 456.780609 2( 2) GIVKVVAVK 42.20 0
Proteins matching the same set of peptides:
CH60_XANC5 Total score: 42.2 Peptides matched: 1
CH60_XANC8 Total score: 42.2 Peptides matched: 1
CH60_XANCH Total score: 42.2 Peptides matched: 1
CH60_XANCP Total score: 42.2 Peptides matched: 1
CH60_XANOM Total score: 42.2 Peptides matched: 1
CH60_XANOR Total score: 42.2 Peptides matched: 1
Proteins matching a subset of these peptides:
Protein Hit 5
===================
Accession : NMDE4_HUMAN
Description :
Score : 37.24
Mass : 0
Frame : 0
Coverage : 10
RMS error : 9.41906700790969
Peptides : 1
-- dim 16 456.780609 3( 3) VAAGVAVVAR 37.24 0
Proteins matching the same set of peptides:
NMDE4_MOUSE Total score: 37.24 Peptides matched: 1
NMDE4_RAT Total score: 36.2762337692848 Peptides matched: 1
Proteins matching a subset of these peptides:
Protein Hit 6
===================
Accession : YF81_THET2
Description :
Score : 34.76
Mass : 0
Frame : 0
Coverage : 9
RMS error : 37.0214184966023
Peptides : 1
-- dim 16 456.780609 4( 4) VAQVLGVVK 34.76 0
Proteins matching the same set of peptides:
Y1944_THET8 Total score: 34.76 Peptides matched: 1
Proteins matching a subset of these peptides:
Protein Hit 7
===================
Accession : F4ST_FLACH
Description :
Score : 33.85
Mass : 0
Frame : 0
Coverage : 9
RMS error : 87.8815544838649
Peptides : 1
-- dim 15 451.249908 2( 2) LSATGLVLK 33.85 0
Proteins matching the same set of peptides:
Proteins matching a subset of these peptides:
Protein Hit 8
===================
Accession : ZN711_HUMAN
Description : Zinc finger protein 711 (Zinc finger protein 6) - Homo sapiens (Human)
Score : 30.84
Mass : 87153.77
Frame : 0
Coverage : 13
RMS error : 69.4028633218151
Peptides : 1
CB BOLD 33 714.364929 1( 1) EASPLSSNKLILR 30.84 0
Proteins matching the same set of peptides:
Proteins matching a subset of these peptides:
Unassigned list
---------------
CB BOLD 14 442.228302 1( 1) LIAQTPLK 25.09 0
CB BOLD 9 747.396179 1( 1) EGETRR 15.03 0
CB BOLD 4 662.275574 1( 1) KNAMAK 14.09 0
CB BOLD 23 1101.621704 1( 1) QLLMVAGVDR 12.04 0
CB BOLD 5 662.417175 1( 1) AIACER 11.79 0
CB BOLD 8 714.372498 1( 1) LAPAQSK 10.69 0
CB BOLD 6 673.349487 1( 1) AVNDVR 10.63 0
CB BOLD 22 1101.536621 1( 1) ENVIPADSEK 8.65 0
CB BOLD 55 1099.094727 1( 1) LNAEAVRTLLSANGQKPSEAK 8.05 0
CB BOLD 29 642.353577 1( 1) VVGVAGQGASALVR 7.91 0
CB BOLD 28 642.352600 1( 1) KNVSVSQGPDPR 7.22 0
CB BOLD 30 663.837891 1( 1) TPLLVGVAKGESR 7.20 0
CB BOLD 50 1048.561523 1( 1) ALDEILEYQNYPVVCAKK 5.70 0
CB BOLD 57 747.036072 1( 1) VMGSAFTALLDANEDAQKAMR 4.83 0
CB BOLD 49 1020.987915 1( 1) HQRLSGLMQTALEEQQR 4.11 0
CB BOLD 19 932.364380 1( 1) TGMTRNPR 4.09 0
CB BOLD 2 500.256012 1( 1) LAVPT 3.87 0
CB BOLD 38 749.383972 1( 1) IDLLADMMWDDK 3.43 2
CB BOLD 20 933.499023 1( 1) SRDPGMVR 3.21 0
CB BOLD 41 886.405884 1( 1) DRVALNQEVMAPEATK 1.85 0
CB BOLD 10 747.412476 1( 1) MAPSTPK 1.68 0
CB BOLD 18 930.703003 1( 1) LGSGIKAER 1.60 0
CB BOLD 7 711.364685 1( 1) GGAHEIK 1.34 0
CB BOLD 17 930.683105 1( 1) KIQAEITK 1.00 0
CB BOLD 44 949.550720 1( 1) LLSWDSVFFIKNITSK 0.30 0
CB BOLD 1 498.272888 1( 1) 0.00 0
CB BOLD 3 575.558411 1( 1) 0.00 0
CB BOLD 32 711.370728 1( 1) 0.00 0
CB BOLD 42 932.460815 1( 1) 0.00 0
CB BOLD 43 933.003784 1( 1) 0.00 0
CB BOLD 47 665.009583 1( 1) 0.00 0
CB BOLD 56 1119.045166 1( 1) 0.00 0
CB BOLD 63 832.798584 1( 1) 0.00 0
CB BOLD 66 1113.894653 1( 1) 0.00 0
CB BOLD 67 1116.177490 1( 1) 0.00 0
Score Delta Hit Protein Peptide
0 0
0 0
0 0
0 0
0 0
0 0
0 0
0 0
0 0
0 0
Accessions that matched query 97 rank 1:-
=cut
